224,000+ productos de investigación
·
Triple ISO certified
·
COA & SDS Disponible para cada producto
·
Same-day shipping on in-stock items
| Descripción | Transcriptional coactivator YAP1 |
|---|
Gene and Protein Information
| Gene ID | 10413 |
|---|---|
| Uniprot Accession IDs | P46937 B4DTY1 B7ZA01 E3WEB5 E3WEB6 E9PRV2 F5H202 K0KQ18 K0KYZ8 K0L195 K0L1G3 Q7Z574 Q8IUY9 Yes-associated protein 1 |
| Ensembl ID | ENSP00000478927 |
| Symbol | YAP65 YAP YKI COB1 YAP2 YAP65 |
| Family | Belongs to the YAP1 family. |
| Sequence |
MDPGQQPPPQPAPQGQGQPPSQPPQGQGPPSGPGQPAPAATQAAPQAPPAGHQIVHVRGDSETDLEALFNAVMNPKTANVPQTVPMRLRKLPDSFFKPPEPKSHSRQASTDAGTAGALTPQHVRAHSSPASLQLGAVSPGTLTPTGVVSGPAATPTAQHLRQSSFEIPDDVPLPAGWEMAKTSSGQRYFLNHIDQTTTWQDPRKAMLSQMNVTAPTSPPVQQNMMNSASGPLPDGWEQAMTQDGEIYYINHKNKTTSWLDPRLDPRFAMNQRISQSAPVKQPPPLAPQSPQGGVMGGSNSNQQQQMRLQQLQMEKERLRLKQQELLRQAMRNINPSTANSPKCQELALRSQLPTLEQDGGTQNPVSSPGMSQELRTMTTNSSDPFLNSGTYHSRDESTDSGLSMSSYSVPRTPDDFLNSVDEMDTGDTINQSTLPSQQNRFPDYLEAIPGTNVDLGTLEGDGMNIEGEELMPSLQEALSSDILNDMESVLAATKLDKESFLTWL
Show more
|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nombre | NIF | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 451506 | YAP1 | Yes associated protein 1 | 9598 | VGNC:3038 | OMA, EggNOG |
| Macaque | 704382 | YAP1 | Yes associated protein 1 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 22601 | Yap1 | yes-associated protein 1 | 10090 | MGI:103262 | Inparanoid, OMA, EggNOG |
| Rat | 363014 | Yap1 | yes-associated protein 1 | 10116 | RGD:1306035 | Inparanoid, OMA, EggNOG |
| Dog | 479465 | YAP1 | Yes associated protein 1 | 9615 | VGNC:49698 | Inparanoid, OMA, EggNOG |
| Horse | 100068834 | YAP1 | Yes associated protein 1 | 9796 | VGNC:25092 | Inparanoid, OMA, EggNOG |
| Cow | 100336629 | YAP1 | Yes associated protein 1 | 9913 | OMA, EggNOG | |
| Platypus | 100079225 | YAP1 | Yes associated protein 1 | 9258 | Inparanoid, OMA, EggNOG | |
| Anole lizard | 100554222 | yap1 | Yes associated protein 1 | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 100488779 | yap1 | Yes associated protein 1 | 8364 | XB-GENE-952394 | Inparanoid, OMA, EggNOG |
| Zebrafish | 561411 | yap1 | Yes-associated protein 1 | 7955 | ZDB-GENE-030131-9710 | Inparanoid, OMA, EggNOG |
Protein Classes
PANTHER Classes
protein / enzyme modulator / kinase modulator / Transcriptional coactivator YAP1
protein / enzyme modulator / transcription cofactor / Transcriptional coactivator YAP1
protein / enzyme modulator / kinase modulator / Transcriptional coactivator YAP1
protein / enzyme modulator / transcription cofactor / Transcriptional coactivator YAP1
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Specifications | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later