224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items
| Descripción | M-phase inducer phosphatase 3 |
|---|
Gene and Protein Information
| Gene ID | 995 |
|---|---|
| Uniprot Accession IDs | P30307 D3DQB8 Q96PL3 Q9H168 Q9H2E8 Q9H2E9 Q9H2F1 |
| Ensembl ID | ENSP00000321656 |
| Symbol | CDC25 PPP1R60 |
| Family | Belongs to the MPI phosphatase family. |
| Sequence | MSTELFSSTREEGSSGSGPSFRSNQRKMLNLLLERDTSFTVCPDVPRTPVGKFLGDSANLSILSGGTPKRCLDLSNLSSGEITATQLTTSADLDETGHLDSSGLQEVHLAGMNHDQHLMKCSPAQLLCSTPNGLDRGHRKRDAMCSSSANKENDNGNLVDSEMKYLGSPITTVPKLDKNPNLGEDQAEEISDELMEFSLKDQEAKVSRSGLYRSPSMPENLNRPRLKQVEKFKDNTIPDKVKKKYFSGQGKLRKGLCLKKTVSLCDITITQMLEEDSNQGHLIGDFSKVCALPTVSGKHQDLKYVNPETVAALLSGKFQGLIEKFYVIDCRYPYEYLGGHIQGALNLYSQEELFNFFLKKPIVPLDTQKRIIIVFHCEFSSERGPRMCRCLREEDRSLNQYPALYYPELYILKGGYRDFFPEYMELCEPQSYCPMHHQDHKTELLRCRSQSKVQEGERQLREQIALLVKDMSP Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nombre | NIF | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 746151 | CDC25C | cell division cycle 25C | 9598 | VGNC:3940 | OMA, EggNOG |
| Macaque | 714115 | CDC25C | cell division cycle 25C | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 12532 | Cdc25c | cell division cycle 25C | 10090 | MGI:88350 | Inparanoid, OMA, EggNOG |
| Rat | 307511 | Cdc25c | cell division cycle 25C | 10116 | RGD:1311875 | Inparanoid, OMA |
| Dog | 610456 | CDC25C | cell division cycle 25C | 9615 | VGNC:38991 | Inparanoid, OMA, EggNOG |
| Horse | 100062352 | CDC25C | cell division cycle 25C | 9796 | VGNC:16292 | Inparanoid, OMA, EggNOG |
| Cow | 507731 | CDC25C | cell division cycle 25C | 9913 | VGNC:27064 | Inparanoid, OMA, EggNOG |
| Pig | 100144474 | CDC25C | cell division cycle 25C | 9823 | Inparanoid, OMA, EggNOG | |
| Opossum | 100025023 | CDC25C | cell division cycle 25C | 13616 | Inparanoid, EggNOG | |
| Anole lizard | 100565034 | cdc25c | cell division cycle 25C | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 100124300 | cdc25c | cell division cycle 25C | 8364 | XB-GENE-944821 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Specifications | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.