Margatoxin, Channel blocker of K v1.1;Channel blocker of K v1.2;Channel blocker of K v1.3;Channel blocker of K v1.7, CAS No.145808-47-5, Channel blocker of K v1.1;Channel blocker of K v1.2;Channel blocker of K v1.3;Channel blocker of K v1.7

CAS: 145808-47-5 Cat. No.: M287709 Peso molecular: 4178.96 Número EC: 686-414-8 PubChem CID: 121596045
Disponible para pedir
GRADE & PURITY Moligand™ ? Moligand™ — Aladdin's line of ligands and bioactive small molecules. Use for receptor, pathway, and binding studies needing defined small-molecule tools.
 ·  off list, applied to all prices below.
Size
Estado
Price
Qty
100μg
M287709-100μg
8-12 wks(?) Production requires sourcing of materials. We appreciate your patience and understanding.
299,90US$
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Moligand™ Moligand™ for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Specifications

Product Name
Margatoxin, Channel blocker of K v1.1;Channel blocker of K v1.2;Channel blocker of K v1.3;Channel blocker of K v1.7, CAS No.145808-47-5
Sinónimos
UNII-6197NL836C | 6197NL836C | HB1083 | Margatoxin | C178H286N52O50S7
Grado
Moligand™
Especificaciones y pureza
Moligand™
Mecanismos bioquímicos y fisiológicos
Potent KV1.3 channel blocker (IC50= 36 pM). Displays no effect at calcium-activated channels. Reduces VEGF-induced transmembrane calcium influxes and nitric oxide production in human endothelial cells.
Secuencia
TIINVKCTSPKQCLPPCKAQFGQSAGAKCMNGKCKCYPH(Modifications: Disulfide bridge between 7 - 29, 13 - 34, 17 - 36)
Tipo de acción
CHANNEL BLOCKER
Mecanismo de acción
Channel blocker of K v1.1;Channel blocker of K v1.2;Channel blocker of K v1.3;Channel blocker of K v1.7
CAS
145808-47-5
Tipo de molécula
Small molecule
Almacenamiento y envío
Condiciones de almacenamiento de almacenamiento
Store at -20°C
Enviado en
Ice chest + Ice pads

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Objetivos asociados (humanos)
KCNA7 Tclin Potassium voltage-gated channel subfamily A member 7 (0 Activities)
Activity TypeActivity Value -log(M)Mechanism of ActionActivity ReferencePublications (PubMed IDs)
KCNA3 Tclin Potassium voltage-gated channel subfamily A member 3 (0 Activities)
Activity TypeActivity Value -log(M)Mechanism of ActionActivity ReferencePublications (PubMed IDs)
KCNA2 Tclin Potassium voltage-gated channel subfamily A member 2 (0 Activities)
Activity TypeActivity Value -log(M)Mechanism of ActionActivity ReferencePublications (PubMed IDs)
KCNA1 Tclin Potassium voltage-gated channel subfamily A member 1 (0 Activities)
Activity TypeActivity Value -log(M)Mechanism of ActionActivity ReferencePublications (PubMed IDs)
Certificados (CoA, COO, BSE/TSE y tabla de análisis)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:
Información genética
Alternate NamesUNII-6197NL836C | 6197NL836C | HB1083 | Margatoxin | C178H286N52O50S7
Reference
  • 1. Kinetics and inhibition of recombinant human cystathionine gamma-lyase. Toward the rational control of transsulfuration., The Journal of biological chemistry, Steegborn, C C and 7 more authors.
  • 2. Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences., Proceedings of the National Academy of Sciences of the United States of America, Strausberg, Robert L RL and 83 more authors.
  • 3. Genomic basis of cystathioninuria (MIM 219500) revealed by multiple mutations in cystathionine gamma-lyase (CTH)., Human genetics, Wang, Jian J and Hegele, Robert A RA.
  • 4. Cloning and nucleotide sequence of human liver cDNA encoding for cystathionine gamma-lyase., Biochemical and biophysical research communications, Lu, Y Y, O'Dowd, B F BF, Orrego, H H and Israel, Y Y.
  • 5. Single nucleotide polymorphism in CTH associated with variation in plasma homocysteine concentration., Clinical genetics, Wang, J J, Huff, A M AM, Spence, J D JD and Hegele, R A RA.
  • 6. Cystathionine gamma-lyase overexpression inhibits cell proliferation via a H2S-dependent modulation of ERK1/2 phosphorylation and p21Cip/WAK-1., The Journal of biological chemistry, Yang, Guangdong G, Cao, Kun K, Wu, Lingyun L and Wang, Rui R.
  • 7. The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)., Genome research, Gerhard, Daniela S DS and 115 more authors.
  • 8. Towards a proteome-scale map of the human protein-protein interaction network., Nature, Rual, Jean-François JF and 37 more authors.
  • 9. The DNA sequence and biological annotation of human chromosome 1., Nature, Gregory, S G SG and 178 more authors.
  • 10. Polymorphisms in one-carbon metabolism and trans-sulfuration pathway genes and susceptibility to bladder cancer., International journal of cancer, Moore, Lee E LE and 14 more authors. more
Preguntas frecuentes y artículos
Calculadoras de soluciones
Reseñas

Reseñas de cliente

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.