FGF7

Description Fibroblast growth factor 7

Gene and Protein Information

Gene ID 2252
Uniprot Accession IDs P21781 H0YNY5 Q6FGV5 Q96FG5 FGF-7
Ensembl ID ENSP00000267843
Symbol KGF KGF HBGF-7
Family Belongs to the heparin-binding growth factors family.
Sequence
MHKWILTWILPTLLYRSCFHIICLVGTISLACNDMTPEQMATNVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIKGVESEFYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHNGGEMFVALNQKGIPVRGKKTKKEQKTAHFLPMAIT
Homologous gene and protein info.
Species Gene ID Gene Symbol Name Tax ID Other Gene ID Sources
Chimp 744975 FGF7 fibroblast growth factor 7 9598 VGNC:11889 OMA, EggNOG
Macaque 574345 FGF7 fibroblast growth factor 7 9544 Inparanoid, OMA, EggNOG
Mouse 14178 Fgf7 fibroblast growth factor 7 10090 MGI:95521 Inparanoid, OMA, EggNOG
Rat 29348 Fgf7 fibroblast growth factor 7 10116 RGD:61805 Inparanoid, OMA, EggNOG
Dog 403915 FGF7 fibroblast growth factor 7 9615 VGNC:40853 Inparanoid, OMA, EggNOG
Horse 100033961 FGF7 fibroblast growth factor 7 9796 VGNC:18020 Inparanoid, OMA, EggNOG
Cow 616885 FGF7 fibroblast growth factor 7 9913 VGNC:28982 Inparanoid, OMA, EggNOG
Opossum 100025923 FGF7 fibroblast growth factor 7 13616 Inparanoid, EggNOG
Chicken 415439 FGF7 fibroblast growth factor 7 9031 CGNC:66242 Inparanoid, OMA
Anole lizard 100558897 fgf7 fibroblast growth factor 7 28377 Inparanoid, OMA, EggNOG
Xenopus 496833 fgf7 fibroblast growth factor 7 8364 XB-GENE-488183 Inparanoid, OMA, EggNOG
Zebrafish 493181 fgf7 fibroblast growth factor 7 7955 ZDB-GENE-080122-1 Inparanoid, OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    signaling molecule    /    growth factor    /    Fibroblast growth factor 7
DTO Classes
protein    /    Signaling    /    Growth factor    /    Fibroblast growth factor 7

Associated Recombinant Proteins

Name Specification and purity Expression system Protein label Availability View Details

Associated Antibodies

Name Specifications Species reactivity Application Availability View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name Direct Associated Targets Disease Type Mondoid

Bibliography

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.