224,000+ research products
·
Triple ISO certified
·
COA & SDS available for every product
·
Same-day shipping on in-stock items
| Description | Serum amyloid A-4 protein |
|---|
Gene and Protein Information
| Gene ID | 6291 |
|---|---|
| Uniprot Accession IDs | P35542 Q6FHJ4 |
| Ensembl ID | ENSP00000278222 |
| Symbol | CSAA CSAA C-SAA |
| Family | Belongs to the SAA family. |
| Sequence |
MRLFTGIVFCSLVMGVTSESWRSFFKEALQGVGDMGRAYWDIMISNHQNSNRYLYARGNYDAAQRGPGGVWAAKLISRSRVYLQGLIDCYLFGNSSTVLEDSKSNEKAEEWGRSGKDPDRFRPDGLPKKY
|
Protein Classes
PANTHER Classes
protein / transfer/carrier protein / defense/immunity protein / Serum amyloid A-4 protein
protein / transfer/carrier protein / apolipoprotein / Serum amyloid A-4 protein
protein / transfer/carrier protein / transporter / Serum amyloid A-4 protein
protein / transfer/carrier protein / defense/immunity protein / Serum amyloid A-4 protein
protein / transfer/carrier protein / apolipoprotein / Serum amyloid A-4 protein
protein / transfer/carrier protein / transporter / Serum amyloid A-4 protein
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later