224,000+ research products
·
Triple ISO certified
·
COA & SDS available for every product
·
Same-day shipping on in-stock items
| Description | Serum amyloid A-2 protein |
|---|
Gene and Protein Information
| Gene ID | 6289 |
|---|---|
| Uniprot Accession IDs | P0DJI9 G3XAK9 P02735 P02736 P02737 Q16730 Q16834 Q16835 Q16879 Q3KRB3 Q6FG67 Q96QN0 Q9UCK9 Q9UCL0 SAA2 |
| Ensembl ID | ENSP00000436126 |
| Symbol | SAA SAA1 |
| Family | Belongs to the SAA family. |
| Sequence |
MKLLTGLVFCSLVLSVSSRSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGAWAAEVISNARENIQRLTGRGAEDSLADQAANKWGRSGRDPNHFRPAGLPEKY
|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 748829 | SAA2 | serum amyloid A2 | 9598 | VGNC:1010 | OMA, EggNOG |
| Mouse | 20209 | Saa2 | serum amyloid A 2 | 10090 | MGI:98222 | Inparanoid, OMA, EggNOG |
| Dog | 751814 | SAA1 | serum amyloid A1 | 9615 | Inparanoid, OMA | |
| Horse | SAA | Equus caballus serum amyloid A1 (SAA), mRNA. [Source:RefSeq mRNA;Acc:NM_001081853] | 9796 | OMA, EggNOG | ||
| Cow | 506412 | SAA2 | serum amyloid A2 | 9913 | OMA, EggNOG | |
| Pig | 100525680 | SAA2 | serum amyloid A-2 protein | 9823 | OMA, EggNOG | |
| Zebrafish | 449557 | saa | serum amyloid A | 7955 | ZDB-GENE-040927-15 | OMA, EggNOG |
Protein Classes
PANTHER Classes
protein / transfer/carrier protein / defense/immunity protein / Serum amyloid A-2 protein
protein / transfer/carrier protein / apolipoprotein / Serum amyloid A-2 protein
protein / transfer/carrier protein / transporter / Serum amyloid A-2 protein
protein / transfer/carrier protein / defense/immunity protein / Serum amyloid A-2 protein
protein / transfer/carrier protein / apolipoprotein / Serum amyloid A-2 protein
protein / transfer/carrier protein / transporter / Serum amyloid A-2 protein
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later