CD24

Description Signal transducer CD24

Gene and Protein Information

Gene ID 100133941
Uniprot Accession IDs P25063 A0A087WYI6 B6EC88 Q16257 Q53XS0 R4I4T5
Ensembl ID ENSP00000483985
Symbol CD24A CD24A
Family Belongs to the CD24 family.
Sequence
MGRAMVARLGLGLLLLALLLPTQIYSSETTTGTSSNSSQSTSNSGLAPNPTNATTKAAGGALQSTASLFVVSLSLLHLYS
Homologous gene and protein info.
Species Gene ID Gene Symbol Name Tax ID Other Gene ID Sources
Mouse 12484 Cd24a CD24a antigen 10090 MGI:88323 Inparanoid, OMA
Rat 25145 Cd24 CD24 molecule 10116 RGD:2298 Inparanoid, OMA
Pig 100519934 LOC100519934 uncharacterized LOC100519934 9823 Inparanoid, OMA

Associated Recombinant Proteins

Name Specification and purity Expression system Protein label Availability View Details

Associated Antibodies

Name Specifications Species reactivity Application Availability View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name Direct Associated Targets Disease Type Mondoid

Bibliography

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.