224,000+ research products
·
Triple ISO certified
·
COA & SDS available for every product
·
Same-day shipping on in-stock items
| Description | C-C chemokine receptor type 5 |
|---|
Gene and Protein Information
| Gene ID | 1234 |
|---|---|
| Uniprot Accession IDs | P51681 O14692 O14693 O14695 O14696 O14697 O14698 O14699 O14700 O14701 O14702 O14703 O14704 O14705 O14706 O14707 O14708 O15538 Q9UPA4 C-C CKR-5 |
| Ensembl ID | ENSP00000292303 |
| Symbol | CMKBR5 CKR5 CCR-5 CD195 CKR-5 CCCKR5 CMKBR5 IDDM22 CC-CKR-5 |
| Family | Belongs to the G-protein coupled receptor 1 family. |
| Sequence |
MDYQVSSPIYDINYYTSEPCQKINVKQIAARLLPPLYSLVFIFGFVGNMLVILILINCKRLKSMTDIYLLNLAISDLFFLLTVPFWAHYAAAQWDFGNTMCQLLTGLYFIGFFSGIFFIILLTIDRYLAVVHAVFALKARTVTFGVVTSVITWVVAVFASLPGIIFTRSQKEGLHYTCSSHFPYSQYQFWKNFQTLKIVILGLVLPLLVMVICYSGILKTLLRCRNEKKRHRAVRLIFTIMIVYFLFWAPYNIVLLLNTFQEFFGLNNCSSSNRLDQAMQVTETLGMTHCCINPIIYAFVGEKFRNYLLVFFQKHIAKRFCKCCSIFQQEAPERASSVYTRSTGEQEISVGL
Show more
|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 450128 | CCR5 | C-C motif chemokine receptor 5 | 9598 | VGNC:11366 | Inparanoid, OMA, EggNOG |
| Mouse | 12774 | Ccr5 | chemokine (C-C motif) receptor 5 | 10090 | MGI:107182 | Inparanoid, OMA, EggNOG |
| Rat | 117029 | Ccr5 | C-C motif chemokine receptor 5 | 10116 | RGD:620596 | Inparanoid, OMA |
| Dog | 484789 | CCR5 | C-C motif chemokine receptor 5 | 9615 | Inparanoid, OMA | |
| Cow | 497017 | CCR5 | C-C motif chemokine receptor 5 | 9913 | Inparanoid, OMA | |
| Pig | 414371 | CCR5 | chemokine (C-C motif) receptor 5 | 9823 | Inparanoid, OMA | |
| Opossum | 100023438 | LOC100023438 | C-C chemokine receptor type 5-like | 13616 | Inparanoid, OMA |
Protein Classes
DTO Classes
protein / G-protein coupled receptor / Class A rhodopsin like / Chemokine receptor / C-C chemokine receptor / C-C chemokine receptor type 5
protein / G-protein coupled receptor / Class A rhodopsin like / Chemokine receptor / C-C chemokine receptor / C-C chemokine receptor type 5
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.