JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

🌎 Ship to: United States

Language

Toggle Nav

Search

Quick Order SDS CoA

Language

྾

224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

CCNE2

Description	G1/S-specific cyclin-E2

Gene and Protein Information

Gene ID	9134
Uniprot Accession IDs	O96020 O95439
Ensembl ID	ENSP00000429089
Symbol	CYCE2
Family	Belongs to the cyclin family. Cyclin E subfamily.
Sequence	MSRRSSRLQAKQQPQPSQTESPQEAQIIQAKKRKTTQDVKKRREEVTKKHQYEIRNCWPPVLSGGISPCIIIETPHKEIGTSDFSRFTNYRFKNLFINPSPLPDLSWGCSKEVWLNMLKKESRYVHDKHFEVLHSDLEPQMRSILLDWLLEVCEVYTLHRETFYLAQDFFDRFMLTQKDINKNMLQLIGITSLFIASKLEEIYAPKLQEFAYVTDGACSEEDILRMELIILKALKWELCPVTIISWLNLFLQVDALKDAPKVLLPQYSQETFIQIAQLLDLCILAIDSLEFQYRILTAAALCHFTSIEVVKKASGLEWDSISECVDWMVPFVNVVKSTSPVKLKTFKKIPMEDRHNIQTHTNYLAMLEEVNYINTFRKGGQLSPVCNGGIMTPPKSTEKPPGKH Show more

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	464292	CCNE2	cyclin E2	9598	VGNC:905	OMA, EggNOG
Macaque	700382	CCNE2	cyclin E2	9544		Inparanoid, OMA
Mouse	12448	Ccne2	cyclin E2	10090	MGI:1329034	Inparanoid, OMA, EggNOG
Rat	362485	Ccne2	cyclin E2	10116	RGD:1307783	Inparanoid, OMA, EggNOG
Dog	487057	CCNE2	cyclin E2	9615	VGNC:54109	Inparanoid, OMA, EggNOG
Horse	100055302	CCNE2	cyclin E2	9796	VGNC:16212	Inparanoid, OMA, EggNOG
Cow	538436	CCNE2	cyclin E2	9913	VGNC:26967	Inparanoid, OMA, EggNOG
Pig	100512048	CCNE2	cyclin E2	9823		Inparanoid, OMA, EggNOG
Opossum	100022654	CCNE2	cyclin E2	13616		OMA, EggNOG
Platypus	100075784	CCNE2	cyclin E2	9258		Inparanoid, OMA, EggNOG
Anole lizard	100563792	ccne2	cyclin E2	28377		Inparanoid, OMA
Xenopus	549021	ccne2	cyclin E2	8364	XB-GENE-923043	Inparanoid, OMA
Zebrafish	415165	ccne2	cyclin E2	7955	ZDB-GENE-030131-9689	Inparanoid, OMA
C. elegans	172399	cye-1	G1/S-specific cyclin-E	6239		Inparanoid, EggNOG

PANTHER Classes
protein / enzyme modulator / kinase activator / G1/S-specific cyclin-E2

DTO Classes
protein / Enzyme modulator / Kinase modulator / Kinase activator / G1/S-specific cyclin-E2

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.