224,000+ research products
·
Triple ISO certified
·
COA & SDS available for every product
·
Same-day shipping on in-stock items
| Description | Homeobox protein CDX-2 |
|---|
Gene and Protein Information
| Gene ID | 1045 |
|---|---|
| Uniprot Accession IDs | Q99626 O00503 Q5VTU7 Q969L8 Q9UD92 |
| Ensembl ID | ENSP00000370408 |
| Symbol | CDX3 CDX3 CDX-3 CDX2/AS |
| Family | Belongs to the Caudal homeobox family. |
| Sequence |
MYVSYLLDKDVSMYPSSVRHSGGLNLAPQNFVSPPQYPDYGGYHVAAAAAAAANLDSAQSPGPSWPAAYGAPLREDWNGYAPGGAAAAANAVAHGLNGGSPAAAMGYSSPADYHPHHHPHHHPHHPAAAPSCASGLLQTLNPGPPGPAATAAAEQLSPGGQRRNLCEWMRKPAQQSLGSQVKTRTKDKYRVVYTDHQRLELEKEFHYSRYITIRRKAELAATLGLSERQVKIWFQNRRAKERKINKKKLQQQQQQQPPQPPPPPPQPPQPQPGPLRSVPEPLSPVSSLQASVPGSVPGVLGPTGGVLNPTVTQ
Show more
|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 467350 | CDX2 | caudal type homeobox 2 | 9598 | VGNC:13071 | Inparanoid, OMA |
| Mouse | 12591 | Cdx2 | caudal type homeobox 2 | 10090 | MGI:88361 | Inparanoid, OMA, EggNOG |
| Rat | 66019 | Cdx2 | caudal type homeo box 2 | 10116 | RGD:621234 | Inparanoid, OMA, EggNOG |
| Dog | 486028 | CDX2 | caudal type homeobox 2 | 9615 | VGNC:39085 | Inparanoid, OMA, EggNOG |
| Horse | 100051406 | CDX2 | caudal type homeobox 2 | 9796 | VGNC:51937 | Inparanoid, OMA |
| Pig | 100127132 | CDX2 | caudal type homeobox 2 | 9823 | Inparanoid, OMA, EggNOG | |
| Opossum | 100019885 | CDX2 | caudal type homeobox 2 | 13616 | Inparanoid, OMA, EggNOG |
Protein Classes
PANTHER Classes
protein / nucleic acid binding / DNA binding protein / Homeobox protein CDX-2
protein / nucleic acid binding / homeodomain transcription factor / Homeobox protein CDX-2
protein / nucleic acid binding / DNA binding protein / Homeobox protein CDX-2
protein / nucleic acid binding / homeodomain transcription factor / Homeobox protein CDX-2
DTO Classes
protein / Transcription factor / Helix-turn-helix transcription factor / Homeodomain transcription factor / Homeobox protein CDX-2
protein / Transcription factor / Helix-turn-helix transcription factor / Homeodomain transcription factor / Homeobox protein CDX-2
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later