🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

CCNB1

Description G2/mitotic-specific cyclin-B1

Gene and Protein Information

Gene ID 891
Uniprot Accession IDs P14635 A8K066 Q5TZP9
Ensembl ID ENSP00000256442
Symbol CCNB CCNB
Family Belongs to the cyclin family. Cyclin AB subfamily.
Sequence
MALRVTRNSKINAENKAKINMAGAKRVPTAPAATSKPGLRPRTALGDIGNKVSEQLQAKMPMKKEAKPSATGKVIDKKLPKPLEKVPMLVPVPVSEPVPEPEPEPEPEPVKEEKLSPEPILVDTASPSPMETSGCAPAEEDLCQAFSDVILAVNDVDAEDGADPNLCSEYVKDIYAYLRQLEEEQAVRPKYLLGREVTGNMRAILIDWLVQVQMKFRLLQETMYMTVSIIDRFMQNNCVPKKMLQLVGVTAMFIASKYEEMYPPEIGDFAFVTDNTYTKHQIRQMEMKILRALNFGLGRPLPLHFLRRASKIGEVDVEQHTLAKYLMELTMLDYDMVHFPPSQIAAGAFCLALKILDNGEWTPTLQHYLSYTEESLLPVMQHLAKNVVMVNQGLTKHMTVKNKYATSKHAKISTLPQLNSALVQDLAKAVAKV
Show more
Homologous gene and protein info.
Species Gene ID Gene Symbol Name Tax ID Other Gene ID Sources
Chimp 461835 CCNB1 cyclin B1 9598 VGNC:3935 OMA, EggNOG
Macaque 699504 CCNB1 cyclin B1 9544 Inparanoid, OMA, EggNOG
Mouse 268697 Ccnb1 cyclin B1 10090 MGI:88302 Inparanoid, OMA, EggNOG
Rat 25203 Ccnb1 cyclin B1 10116 RGD:2291 Inparanoid, OMA
Horse 100050093 CCNB1 cyclin B1 9796 VGNC:16204 Inparanoid, OMA, EggNOG
Cow 327679 CCNB1 cyclin B1 9913 VGNC:26958 Inparanoid, OMA, EggNOG
Pig 397662 CCNB1 cyclin B1 9823 Inparanoid, OMA, EggNOG
Opossum 100019387 CCNB1 cyclin B1 13616 Inparanoid, OMA, EggNOG
Platypus 100083344 CCNB1 cyclin B1 9258 Inparanoid, OMA, EggNOG
Anole lizard 100557278 ccnb1 cyclin B1 28377 Inparanoid, OMA, EggNOG
Xenopus 394726 ccnb1.2 cyclin B1 8364 XB-GENE-5736422 Inparanoid, OMA
Zebrafish 58025 ccnb1 cyclin B1 7955 ZDB-GENE-000406-10 Inparanoid, OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    enzyme modulator    /    kinase activator    /    G2/mitotic-specific cyclin-B1
DTO Classes
protein    /    Enzyme modulator    /    Kinase modulator    /    Kinase activator    /    G2/mitotic-specific cyclin-B1

Associated Recombinant Proteins

Name Specification and purity Expression system Protein label Availability View Details

Associated Antibodies

Name Specifications Species reactivity Application Availability View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name Direct Associated Targets Disease Type Mondoid

Bibliography

🔙[Back to Target (Human)]
We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.

Privacy Policy Website Terms of Use Return policy Terms and Conditions of Sale Cookie Policy Sales Policy
Products are supplied to verified businesses/institutions and qualified professionals for R&D use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023-present Aladdin Scientific Corp . All rights reserved.