JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

🌎 Ship to: United States

Language

Toggle Nav

Search

Quick Order SDS CoA

Language

྾

224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

HIST1H3A

Description	Histone H3.1

Gene and Protein Information

Gene ID	8350
Uniprot Accession IDs	P68431 A0PJT7 A5PLR1 P02295 P02296 P16106 Q6ISV8 Q6NWP8 Q6NWP9 Q6NXU4 Q71DJ3 Q93081
Ensembl ID	ENSP00000484841
Symbol	H3FA H3/A H3FA
Family	Belongs to the histone H3 family.
Sequence	MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Mouse	360198	Hist1h3a	histone cluster 1, H3a	10090	MGI:2668828	Inparanoid, OMA

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.