Recombinant Mouse IL-13 Protein, >98%(SDS-PAGE,HPLC), high purity

Features and benefits
  • Expression System: E.coli
  • Accession #: P20109
  • Protein Tag: No tag
  • Bioactivity: Measured in a cell proliferation assay using TF‑1 human erythroleukemic cells. The ED₅₀ for this effect is typically <4ng/mL.
  • Endotoxin Concentration: <0.01 EU/μg
Item Number
rp154139
Grouped product items
SKUSizeAvailabilityPrice Qty
rp154139-10μg
10μg
Available within 8-12 weeks(?)
Production requires sourcing of materials. We appreciate your patience and understanding.
$179.90
rp154139-20μg
20μg
3
$279.90
rp154139-100μg
100μg
2
$999.90
rp154139-1mg
1mg
Available within 8-12 weeks(?)
Production requires sourcing of materials. We appreciate your patience and understanding.
$4,459.90

Animal free, >98%(SDS-PAGE,HPLC), Active, E.coli, No tag, 21-131 aa

Basic Description

Product NameRecombinant Mouse IL-13 Protein, >98%(SDS-PAGE,HPLC), high purity
GradeActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free, High Performance
Product Description

Murine Interleukin-13 (IL-13) is expressed by the IL13 gene located on the chromosome 11 and secreted by many cell types, especially T helper type 2 (Th2) cells. Targeted deletion of IL-13 in mice resulted in impaired Th2 cell development and indicated an important role for IL-13 in the expulsion of gastrointestinal parasites. IL-13 exerts anti-inflammatory effects on monocytes and macrophages and it inhibits the expression of inflammatory cytokines such as IL-1β, TNF-α, IL-6 and IL-8. IL-13 has also been shown to enhance B cell proliferation and to induce isotype switching, resulting in increased production of IgE. Blocking of IL-13 activity inhibits the pathophysiology of asthma. Human, mouse and rat IL-13 share low homology, but have cross species activity. Recombinant Murine IL-13 is a 12.3kDa protein consisting of 111 amino acid residues


Purity

>98%(SDS-PAGE,HPLC)


Function

Cytokine. Inhibits inflammatory cytokine production. Synergizes with IL2 in regulating interferon-gamma synthesis. May be critical in regulating inflammatory and immune responses . Positively regulates IL31RA expression in macrophages.


Specifications & PurityActiBioPure™, Bioactive, Animal Free, Carrier Free, Azide Free, High performance, ≥98%(SDS-PAGE&HPLC)
Purity>98%(SDS-PAGE,HPLC)
BioactivityMeasured in a cell proliferation assay using TF‑1 human erythroleukemic cells. The ED₅₀ for this effect is typically <4ng/mL.
Endotoxin Concentration<0.01 EU/μg
Expression SystemE.coli
SpeciesMouse
Amino Acids22-131 aa
SequenceMPVPRSVSLPLTLKELIEELSNITQDQTPLCNGSMVWSVDLAAGGF CVALDSLTNISNCNAIYRTQRILHGLCNRKAPTTVSSLPDTKIEVAHF ITKLLSYTKQLFRHGPF
Protein TagNo tag
Protein LengthFull length protein
Accession #P20109
SourceRecombinant
Predicted molecular weight 12.3 kDa

AI Insight

Images

Recombinant Mouse IL-13 Protein (rp154139)-Protein Bioactivity
Measured in a cell proliferation assay using TF‑1 human erythroleukemic cells. The ED₅₀ for this effect is typically <4ng/mL.

Recombinant Mouse IL-13 Protein (rp154139)-SDS-PAGE
3μg/lane of Recombinant Mouse IL-13 was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a single band at 11.2 kDa.

Product Specifications

FormLyophilized
Reconstitution 1、 This vial must be briefly centrifuged prior to opening to bring the contents to the bottom. 2、 Reconstitute in a sterile aqueous buffer to an appropriate concentration.
Storage TempStore at -20°C,Avoid repeated freezing and thawing
Shipped InIce chest + Ice pads
Stability And StorageFor long term storage, the product should be stored ≤ -20℃ . Avoid freeze / thaw cycle.

Certificates(CoA,COO,BSE/TSE and Analysis Chart)

C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

2 results found

Lot NumberCertificate TypeDateItem
ZJ23F0400125Certificate of AnalysisApr 29, 2023 rp154139
ZJ23F0400124Certificate of AnalysisApr 29, 2023 rp154139

Related Documents

Reviews

Customer Reviews

Solution Calculators