| SKU | Size | Availability | Price | Qty |
|---|---|---|---|---|
| rp183615-10μg (Trial Size) Apply for free trial size（?） Every year, as a valued customer, you have the exclusive opportunity to explore and enjoy three different trial products of your choice, absolutely free! | 10μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $53.90 | |
| rp183615-50μg | 50μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $106.90 | |
| rp183615-100μg | 100μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $169.90 | |
| rp183615-1mg | 1mg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $999.90 |
Animal Free, ≥95% (SDS-PAGE), Active, HEK293, C-His, 1-203 aa
| Product Name | Recombinant Human Ephrin-A5 Protein |
|---|---|
| Synonyms | AF1 | AL-1 | EFL-5 | EFNA5 | EPH-related receptor tyrosine kinase ligand 7 | EphrinA5 | Ephrin-A5 | EPLG7 | GLC1M | LERK-7 | LERK7EFL5 | RAGS |
| Grade | ActiBioPure™, Animal Free, Bioactive, Carrier Free |
| Specifications & Purity | ActiBioPure™, Bioactive, Animal Free, Carrier Free, ≥95%(SDS-PAGE) |
| Biochemical and Physiological Mechanisms | Ephrin-A5 also known as EFNA5, is a member of the Ephrin family. The Eph family receptor interacting proteins (ephrins) are a family of proteins that serve as the ligands of the Eph receptor, which compose the largest known subfamily of receptor protein-t |
| Bioactivity | Immobilized Recombinant Human Ephrin-A5 Protein (rp183615) at 1.0 μg/mL can bind Recombinant Human EphA4 Protein (rp183616) with the EC50 of 175.1 ng/mL. |
| Endotoxin Concentration | <1.0 EU/μg |
| Amino Acids | 1-203 aa |
| Sequence | MLHVEMLTLVFLVLWMCVFSQDPGSKAVADRYAVYWNSSNPRFQRGDYHIDVCINDYLDVFCPHYEDSVPEDKTERYVLYMVNFDGYSACDHTSKGFKRWECNRPHSPNGPLKFSEKFQLFTPFSLGFEFRPGREYFYISSAIPDNGRRSCLKLKVFVRPTNSCMKTIGVHDRVFDVNDKVENSLEPADDTVHESAEPSRGENHHHHHH |
| Predicted molecular weight | 22.0 kDa |
| SDS-PAGE | 26.0 kDa, under reducing conditions; 25.1 kDa, under non-reducing conditions. |
Recombinant Human Ephrin-A5 Protein (rp183615) - Binding Activity
Immobilized Recombinant Human Ephrin-A5 Protein (rp183615) at 1.0 μg/mL can bind Recombinant Human EphA4 Protein (rp183616) with the EC50 of 175.1 ng/mL.
Recombinant Human Ephrin-A5 Protein (rp183615) - SDS-PAGE
3 μg/lane of Recombinant Human Ephrin-A5 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 26.0 kDa under reducing conditions and 25.1 kDa under non-reducing conditions.
| Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 0.5 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions. |
|---|---|
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
| Shipped In | Ice chest + Ice pads |
| Stability And Storage | Store at -20°C for 1 year. Avoid freeze/thaw cycle. |
